DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG30287

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:268 Identity:74/268 - (27%)
Similarity:109/268 - (40%) Gaps:58/268 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RIINGSVAKADETRHLVSI---RLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYNNQRKRFRRA 93
            |:|||..|.......:|.|   .:::          |||:||.||.|||||||....:.:...|.
  Fly    41 RVINGKPADLFSNPWMVIIIERGMMK----------CGGSLITPRYVLTAAHCKSETKSQLTVRL 95

  Fly    94 SEFVV-------VLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLRTGLPMSPGGG 151
            .::.|       ..|.:.|....|.|       ..|:.:...:..::|:.:|.|.|  .:..|..
  Fly    96 GDYDVNQAVDCSSYGCIPRPREINVT-------RTYVPSHYTNFRKNDIALLRLET--TVQYGDN 151

  Fly   152 VHLTVAPIQLAGQITPPGKLCQ------VAGWGRTEQSSLSNILLTANVSTIRHQTCRMIYRSGL 210
            :.   :...|.|..|....:.:      ..||||||....|.:|..|:::......|..::...|
  Fly   152 IR---SICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTHHHLSYCAQVFGKQL 213

  Fly   211 LPGMMCAGRLQGGTDSCQGDSGGPLVHEGR--------LVGVVSWG----YGCAEPGLPGVYVDV 263
            ....:|.....|.|  |||||||||....|        |.||||:|    :|      |.||.:|
  Fly   214 DKSHICVASSTGST--CQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG------PTVYTNV 270

  Fly   264 EYYRQWIE 271
            .::..|||
  Fly   271 IHFANWIE 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 71/265 (27%)
Tryp_SPc 33..271 CDD:238113 71/265 (27%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 71/265 (27%)
Tryp_SPc 42..280 CDD:238113 73/267 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442139
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.