DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and PRSS36

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:257 Identity:87/257 - (33%)
Similarity:124/257 - (48%) Gaps:32/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYNNQRKRFRRASE 95
            :||:.||.|:.......||   |.|    |.||||||:||||..||:||||...|  .....|:|
Human    45 ARIVGGSNAQPGTWPWQVS---LHH----GGGHICGGSLIAPSWVLSAAHCFMTN--GTLEPAAE 100

  Fly    96 FVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLRTGLPMSPGGGVHLTVAPIQ 160
            :.|:||..::....:|.....|:::.....:|...:..|:.:|.|.:...:.|      .|.|:.
Human   101 WSVLLGVHSQDGPLDGAHTRAVAAIVVPANYSQVELGADLALLRLASPASLGP------AVWPVC 159

  Fly   161 L--AGQITPPGKLCQVAGWGRTEQSS---LSNILLTANVSTIRHQTCRMIYRS--------GLLP 212
            |  |......|..|...|||..:::.   |..:|....:..:...||:.:|..        .:||
Human   160 LPRASHRFVHGTACWATGWGDVQEADPLPLPWVLQEVELRLLGEATCQCLYSQPGPFNLTLQILP 224

  Fly   213 GMMCAGRLQGGTDSCQGDSGGPLVHE--GR--LVGVVSWGYGCAEPGLPGVYVDVEYYRQWI 270
            ||:|||..:|..|:||||||||||.|  ||  ..|:.|:|:||.....|||:..|..|..||
Human   225 GMLCAGYPEGRRDTCQGDSGGPLVCEEGGRWFQAGITSFGFGCGRRNRPGVFTAVATYEAWI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 85/254 (33%)
Tryp_SPc 33..271 CDD:238113 86/255 (34%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 85/254 (33%)
Tryp_SPc 47..289 CDD:238113 86/255 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.