DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and Prss28

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:291 Identity:73/291 - (25%)
Similarity:122/291 - (41%) Gaps:58/291 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LFWFLLAC-------AAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALI 70
            |....|:|       |:..:..::...|:.|......:....||:|:..::.| ...|||||::|
Mouse     4 LLLLALSCLESTVFMASVSISRSKPVGIVGGQCTPPGKWPWQVSLRMYSYEVN-SWVHICGGSII 67

  Fly    71 APRKVLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPD----SM 131
            .|:.:||||||:.:....    .:.:.|.:|.:..::.:....:|::    .:|   ||    |.
Mouse    68 HPQWILTAAHCIQSQDAD----PAVYRVQVGEVYLYKEQELLNISRI----IIH---PDYNDVSK 121

  Fly   132 RDDVGILFLRTGLPMSPGGGVHLTVAPIQLA--GQITPPGKLCQVAGWGRTEQSSLSNI------ 188
            |.|:.::.|...|..|      ..|:|:.|.  .........|.:.|||    :.|..:      
Mouse   122 RFDLALMQLTALLVTS------TNVSPVSLPKDSSTFDSTDQCWLVGWG----NLLQRVPLQPPY 176

  Fly   189 -LLTANVSTIRHQTCRMIYRS---------GLLPGMMCAGRLQGGTDSCQGDSGGPLV----HEG 239
             |....:....:::|:..||.         .:...|:|||  ..|...|.||||||||    ::.
Mouse   177 QLHEVKIPIQDNKSCKRAYRKKSSDEHKAVAIFDDMLCAG--TSGRGPCFGDSGGPLVCWKSNKW 239

  Fly   240 RLVGVVSWGYGCAEPGLPGVYVDVEYYRQWI 270
            ..|||||.|..|:. .||.::..|:....||
Mouse   240 IQVGVVSKGIDCSN-NLPSIFSRVQSSLAWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 67/263 (25%)
Tryp_SPc 33..271 CDD:238113 69/264 (26%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 69/264 (26%)
Tryp_SPc 31..269 CDD:214473 67/262 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.