DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and PIK3IP1

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_443112.2 Gene:PIK3IP1 / 113791 HGNCID:24942 Length:263 Species:Homo sapiens


Alignment Length:71 Identity:17/71 - (23%)
Similarity:25/71 - (35%) Gaps:20/71 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 PGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYYRQW--IEGRS 274
            ||:.|...|    |:..|.:..|      :.|..:..| |..|       |.:....|  :.|.:
Human    42 PGLRCLNWL----DAQSGLASAP------VSGAGNHSY-CRNP-------DEDPRGPWCYVSGEA 88

  Fly   275 GAPHSR 280
            |.|..|
Human    89 GVPEKR 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 13/59 (22%)
Tryp_SPc 33..271 CDD:238113 13/60 (22%)
PIK3IP1NP_443112.2 KR 22..102 CDD:238056 17/71 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..263
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143075
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.