powered by:
Protein Alignment CG14780 and PIK3IP1
DIOPT Version :9
Sequence 1: | NP_569920.2 |
Gene: | CG14780 / 31102 |
FlyBaseID: | FBgn0025383 |
Length: | 302 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_443112.2 |
Gene: | PIK3IP1 / 113791 |
HGNCID: | 24942 |
Length: | 263 |
Species: | Homo sapiens |
Alignment Length: | 71 |
Identity: | 17/71 - (23%) |
Similarity: | 25/71 - (35%) |
Gaps: | 20/71 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 212 PGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYYRQW--IEGRS 274
||:.|...| |:..|.:..| :.|..:..| |..| |.:....| :.|.:
Human 42 PGLRCLNWL----DAQSGLASAP------VSGAGNHSY-CRNP-------DEDPRGPWCYVSGEA 88
Fly 275 GAPHSR 280
|.|..|
Human 89 GVPEKR 94
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165143075 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.