DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and KLK11

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_011524671.1 Gene:KLK11 / 11012 HGNCID:6359 Length:307 Species:Homo sapiens


Alignment Length:287 Identity:92/287 - (32%)
Similarity:131/287 - (45%) Gaps:47/287 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ILFWFLLACAAADLQENQQSRIINGSVAKADETRHLVSI----RLLRHDNNFGSGHICGGALIAP 72
            ||...|||.|...:  ..::|||.|...|........::    |||           ||..||||
Human    35 ILQLILLALATGLV--GGETRIIKGFECKPHSQPWQAALFEKTRLL-----------CGATLIAP 86

  Fly    73 RKVLTAAHCL---------------YNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAY 122
            |.:|||||||               .::........|.::|.||..| .:...|...::.::.::
Human    87 RWLLTAAHCLKPWVSLTSPTHVSPDLSSSNYCLSHLSRYIVHLGQHN-LQKEEGCEQTRTATESF 150

  Fly   123 MHTFSPDSM-----RDDVGILFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTE- 181
            .|....:|:     |:|  |:.::...|:|    :...|.|:.|:.:....|..|.::|||.|. 
Human   151 PHPGFNNSLPNKDHRND--IMLVKMASPVS----ITWAVRPLTLSSRCVTAGTSCLISGWGSTSS 209

  Fly   182 -QSSLSNILLTANVSTIRHQTCRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVV 245
             |..|.:.|..||::.|.||.|...|...:...|:||...:||.||||||||||||....|.|::
Human   210 PQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGII 274

  Fly   246 SWGYG-CAEPGLPGVYVDVEYYRQWIE 271
            |||.. ||....||||..|..|..||:
Human   275 SWGQDPCAITRKPGVYTKVCKYVDWIQ 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 84/264 (32%)
Tryp_SPc 33..271 CDD:238113 84/264 (32%)
KLK11XP_011524671.1 Tryp_SPc 53..300 CDD:214473 84/264 (32%)
Tryp_SPc 54..303 CDD:238113 85/266 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.