DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and LOC101730792

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_031762443.1 Gene:LOC101730792 / 101730792 -ID:- Length:146 Species:Xenopus tropicalis


Alignment Length:121 Identity:50/121 - (41%)
Similarity:72/121 - (59%) Gaps:4/121 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 LTVAPIQLAGQITPPGKLCQVAGWGRTEQ--SSLSNILLTANVSTIRHQTCR--MIYRSGLLPGM 214
            ::|.|:.:.|.....|:||||:|||.|..  ...|:.|.:..:..:..:.|.  ..|...:...|
 Frog    21 VSVVPLPIQGVSPIEGRLCQVSGWGFTSTIGGKPSDTLRSVKLPIVPMRKCNSSASYAGHITSNM 85

  Fly   215 MCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYYRQWI 270
            :|||.:.||.|:||||||||||.:|::.||||||:.||.|..||||..|..:::||
 Frog    86 ICAGFITGGKDACQGDSGGPLVCDGKVYGVVSWGHSCANPKYPGVYTAVANFQRWI 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 48/119 (40%)
Tryp_SPc 33..271 CDD:238113 50/121 (41%)
LOC101730792XP_031762443.1 Tryp_SPc <7..141 CDD:214473 48/119 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.