DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and LOC100490788

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001333500.1 Gene:LOC100490788 / 100490788 -ID:- Length:249 Species:Xenopus tropicalis


Alignment Length:271 Identity:85/271 - (31%)
Similarity:117/271 - (43%) Gaps:51/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAH 80
            ||...|||.|.::  .:|:.|    .:.|.|....::.   ..|...:.|||:||:||.:::|||
 Frog     9 FLAVAAAAPLDDD--DKIVGG----YECTPHSQPWQVF---FTFNGRNWCGGSLISPRWIISAAH 64

  Fly    81 CLYNNQRKRFRRASEFVVVLGTLNRFEH----RNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLR 141
            |        ::.....|.:||     ||    :.||........||.|....|...|. .|:.::
 Frog    65 C--------YQPPKTLVALLG-----EHDLKKKEGTEQHIQVEAAYKHFGYKDEAYDH-DIMLVK 115

  Fly   142 TGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQSSLSNILLTANV-----------S 195
            ...|..    .:..|.||.:|......|..|.|:|:|.         ||..|:           .
 Frog   116 LAKPAQ----YNQYVQPIPVARSCPTDGAKCLVSGYGN---------LLAYNIRYPDQLQCLDLP 167

  Fly   196 TIRHQTCRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVY 260
            .:...:|:..|...:...|.|||.|:|..|||||||||||:..|.|.||||||..||....||||
 Frog   168 ILSDSSCKASYPRQISENMFCAGFLEGEKDSCQGDSGGPLICSGELYGVVSWGRYCARKNAPGVY 232

  Fly   261 VDVEYYRQWIE 271
            ..|..|..||:
 Frog   233 AKVCNYLDWIK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 77/252 (31%)
Tryp_SPc 33..271 CDD:238113 78/252 (31%)
LOC100490788NP_001333500.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.