DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and LOC100485189

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_002941065.2 Gene:LOC100485189 / 100485189 -ID:- Length:249 Species:Xenopus tropicalis


Alignment Length:270 Identity:81/270 - (30%)
Similarity:116/270 - (42%) Gaps:39/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 YILFWFLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKV 75
            :||  |:.|.....:|.....|||.|:..:.:......|:       .:...|:|||.||....|
 Frog     2 FIL--FVSALLGTAVQARYYDRIIGGTECRPNSQPWHCSL-------YYFDQHVCGGVLIDENWV 57

  Fly    76 LTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFL 140
            ||||||          :.|...|.||..|...:......|....|.....|:|.:..:|  |:.|
 Frog    58 LTAAHC----------QLSSLQVRLGEHNLAVYEGKEQFSYAEKMCPHSGFNPITFDND--IMLL 110

  Fly   141 RTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRT--EQSSLSNILLTANVSTIRHQTCR 203
            :...|::    ::..|..|.|.......|:.|.|:|||.|  .:.:..:.|....|.|:....|:
 Frog   111 KLVSPVT----INDYVQTIPLGCPTVGDGETCLVSGWGTTTSPEETFPDELQCVEVQTVSQDYCQ 171

  Fly   204 MIYRSGLLP------GMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWG-YGCAEPGLPGVYV 261
                 |..|      .|:|||.::||.||||||||||||....:.|:.||| ..|.....||:|.
 Frog   172 -----GAFPTDEITDNMLCAGVMEGGKDSCQGDSGGPLVCNSMVHGITSWGNTPCGVANKPGIYT 231

  Fly   262 DVEYYRQWIE 271
            .:..|..||:
 Frog   232 KICNYIAWIQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 74/246 (30%)
Tryp_SPc 33..271 CDD:238113 74/246 (30%)
LOC100485189XP_002941065.2 Tryp_SPc 22..243 CDD:238113 75/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.