DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and gzma

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_012808240.1 Gene:gzma / 100135014 XenbaseID:XB-GENE-482759 Length:267 Species:Xenopus tropicalis


Alignment Length:253 Identity:75/253 - (29%)
Similarity:115/253 - (45%) Gaps:33/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYNNQRKRFRRASEFV 97
            ||:|..|.:....::..|.     :..||   |||.||....|||||||:.||..          
 Frog    35 IIDGREAASHSRPYMAYIY-----SRTGS---CGGTLIKQNWVLTAAHCVVNNSE---------- 81

  Fly    98 VVLGTLNRFEHRNGTIVSQVSSMAYMH-TFSPDSMRDDVGILFLRTGLPMSPGGGVHLTVAPIQL 161
            |:||. ::.:.|.........:.|..| .|.......|:.:|.::....::.    .::|..:..
 Frog    82 VILGA-HKVKSRENEQQRFSVARAIPHPCFEWKKKIHDIQLLQIKGAAKLNK----FVSVLKLPT 141

  Fly   162 AGQITPPGKLCQVAGWGRTEQS--SLSNILLTANVSTIRHQTCRMIY---RSGLLPGMMCAG--- 218
            ......||..|..||||.|:.:  :.|::|...||:.:...||..||   ::.:...|:|||   
 Frog   142 TDMDVKPGSSCSTAGWGVTKPNGKTPSDVLREVNVTVVDRGTCNKIYKKFKTEISTNMLCAGAPK 206

  Fly   219 RLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDV-EYYRQWIEGRSG 275
            :.....|:|||||||||:......|:||:|..|.:|..||:|..: ..|.|||...:|
 Frog   207 KSDKKYDACQGDSGGPLICGKEFSGIVSFGKKCGDPKYPGIYTRLTARYLQWIRDVTG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 72/246 (29%)
Tryp_SPc 33..271 CDD:238113 73/247 (30%)
gzmaXP_012808240.1 Tryp_SPc 35..262 CDD:238113 74/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.