DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and Gm2663

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001096130.1 Gene:Gm2663 / 100040208 MGIID:3780832 Length:247 Species:Mus musculus


Alignment Length:262 Identity:80/262 - (30%)
Similarity:117/262 - (44%) Gaps:25/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ILFWFLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVL 76
            |:|:|....||..|..|...:|:.|.........:.||:       |.|..|.|||:||..:.||
Mouse     3 IIFFFTFLGAAVALPANSDDKIVGGYTCPKHSVPYQVSL-------NDGISHQCGGSLINDQWVL 60

  Fly    77 TAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLR 141
            :||||        ::|..:  |.||..|......|........:.....::.|::.:|:.::.|:
Mouse    61 SAAHC--------YKRRLQ--VRLGEHNIDVLEGGEQFIDAEKIIRHPDYNKDTVDNDIMLIKLK 115

  Fly   142 TGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQ--SSLSNILLTANVSTIRHQTCRM 204
                 || ..::..|:.:.|..........|.|:|||.|..  .....:|.......:...:|:.
Mouse   116 -----SP-AILNSQVSTVSLPRSCASTNAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKK 174

  Fly   205 IYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYYRQW 269
            .|...:...|.|.|.|:||.|||.||||||:|..|.:.|:||||..||..|.||||..|..|..|
Mouse   175 SYPGQITSNMFCLGFLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSW 239

  Fly   270 IE 271
            |:
Mouse   240 IQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 71/239 (30%)
Tryp_SPc 33..271 CDD:238113 72/239 (30%)
Gm2663NP_001096130.1 Tryp_SPc 23..240 CDD:214473 71/239 (30%)
Tryp_SPc 24..243 CDD:238113 73/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.