DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pck and lim2.5

DIOPT Version :9

Sequence 1:NP_569919.2 Gene:pck / 31101 FlyBaseID:FBgn0013720 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001013540.1 Gene:lim2.5 / 541395 ZFINID:ZDB-GENE-050320-94 Length:173 Species:Danio rerio


Alignment Length:194 Identity:46/194 - (23%)
Similarity:76/194 - (39%) Gaps:61/194 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GVVFGAIVTFASFFVLMMSFCSPYWIESYEETRASFKNMGLWQYCFKDFVYPKYAFLKQFTGCHN 92
            |.:|.|||   ...:|::|..:.||::  .....||.:.|||:||...         |.:|...:
Zfish     7 GGLFCAIV---GNILLVVSTATDYWMQ--YRLSGSFAHQGLWRYCMSG---------KCYTQTDS 57

  Fly    93 IFSHEYYVIREYLLPGWLMAVQGFVTMSFIIVF--LVLALLSLTIIRLPLKAVLQYEWLLVRLSY 155
            |              .:..|.:.|:.:|.:..|  ::..:||..    ...|..::.    |...
Zfish    58 I--------------AYWNATRAFMILSAMSCFAGIIAGILSFA----HFSAFERFN----RSFA 100

  Fly   156 MGTA--ISSLFMFLAVCIFGGCAYR------RDWMMYPKFNVLGWSYALAVVTFMLLGLAALIL 211
            .|..  ||:||:.||:.|:.|....      .||    :|:   |||        :||..||::
Zfish   101 AGIMFFISTLFVLLAMAIYTGVTVNFLGKRFGDW----RFS---WSY--------ILGWVALLM 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pckNP_569919.2 PMP22_Claudin 39..211 CDD:304458 41/181 (23%)
lim2.5NP_001013540.1 PMP22_Claudin 1..157 CDD:304458 46/194 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1279397at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.