DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pck and kune

DIOPT Version :9

Sequence 1:NP_569919.2 Gene:pck / 31101 FlyBaseID:FBgn0013720 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_610179.2 Gene:kune / 35504 FlyBaseID:FBgn0033032 Length:264 Species:Drosophila melanogaster


Alignment Length:227 Identity:76/227 - (33%)
Similarity:123/227 - (54%) Gaps:23/227 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ATNGVVFGAIVTFASFFVL---MMSFCSPYWIES---YEETRASFKNMGLWQYCFKDFVYPKYAF 83
            |:|.::  .:...||.|.|   :::|.:|||:.:   .:..|  |.|:|||:.||.:|......|
  Fly     3 ASNRIL--QVALCASVFSLICFVIAFSTPYWLVTDGRLQNPR--FTNLGLWEVCFNNFQDIHRFF 63

  Fly    84 LKQFTGCHNIFSHEYYVIREYLLPGWLMAVQGFVTMSFIIVFLVLALLSLTIIRLPLKAVLQYEW 148
            ...|.||..:|..|||:|.::||||:.::||.|.|:.|:   :.|.::.||:..  |:.....:.
  Fly    64 DNSFNGCLWVFEEEYYIIHDFLLPGFYISVQLFATLCFV---MCLVVIPLTVAF--LRTSRDDDR 123

  Fly   149 LLVRLSYMGT--AISSLFMFLAVCIFGGCAYRRDWMMYPKFNVLGWSYALAVVTFMLLGLAALIL 211
            .:|.|..:|:  .:.|:|.|:||.|||.....||||...:.|.:|||:||.||..:||..:.::.
  Fly   124 YMVLLLAIGSCQVVGSVFGFIAVVIFGAKGDSRDWMPGWQNNDMGWSFALGVVGAVLLLPSGVLY 188

  Fly   212 QREARQAYDARGEQKNLVMQMEMQEPG---YQ 240
            ..|||:   .|.::.|.:...|:.|.|   ||
  Fly   189 LVEARR---ERYKRLNEISNREISEYGDEYYQ 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pckNP_569919.2 PMP22_Claudin 39..211 CDD:304458 63/179 (35%)
kuneNP_610179.2 Claudin_2 16..190 CDD:290614 62/180 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447769
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CKEE
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21284
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.