DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pck and LOC101731523

DIOPT Version :9

Sequence 1:NP_569919.2 Gene:pck / 31101 FlyBaseID:FBgn0013720 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_031747937.1 Gene:LOC101731523 / 101731523 -ID:- Length:172 Species:Xenopus tropicalis


Alignment Length:186 Identity:38/186 - (20%)
Similarity:70/186 - (37%) Gaps:49/186 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GAIVTFASFFVLMMSFCSPYWIESYEETRASFKNMGLWQYCFKDFVYPKYAFLKQFTGCHNIFSH 96
            |.:.......:|:::..:.:|:: |..: .:..|.|||::|    |..|         ||   :|
 Frog     8 GLLCAVCGLVLLIVATATDFWMQ-YRYS-GNLSNQGLWRFC----VAGK---------CH---AH 54

  Fly    97 EYYVIREYLLPGWLMAVQGFVTMSFIIVFLVLALLSLTIIRLPLKAVLQYEWLLVRLSYMGTA-- 159
            ...|       .:..|.:.|:.:|.:..|..: :|.||......:|        .|....|..  
 Frog    55 TITV-------AFWDATRAFMLLSILSSFAGI-ILGLTAFSSEARA--------ARTRSAGATLL 103

  Fly   160 ISSLFMFLAVCIFGGCAYR------RDWMMYPKFNVLGWSYALAVVTFMLLGLAAL 209
            ::..|..||:.::.|....      .||    :|:   |||.|..:..:|...|.:
 Frog   104 VAGFFALLALAVYTGVTVNFFGKRFADW----RFS---WSYILGWIGVILTVCAGI 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pckNP_569919.2 PMP22_Claudin 39..211 CDD:304458 37/179 (21%)
LOC101731523XP_031747937.1 PMP22_Claudin 1..153 CDD:419754 38/186 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1279397at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.