DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14778 and Mpv17l

DIOPT Version :10

Sequence 1:NP_569918.1 Gene:CG14778 / 31100 FlyBaseID:FBgn0029580 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_291042.2 Gene:Mpv17l / 93734 MGIID:2135951 Length:194 Species:Mus musculus


Alignment Length:167 Identity:47/167 - (28%)
Similarity:76/167 - (45%) Gaps:5/167 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WQNFKVFVTRYPIMRGMISYSLIWPTGSLIQQTVEGRRWGTYDWWRVLRFSMYGGLFVAPTLYGW 71
            |:.|.....|||....::.|:.::..|..:||.:.|   |..||.:..|.:.....|.....|.|
Mouse     5 WRAFPQAARRYPWPTNVLLYAGLFSAGDALQQRLRG---GPADWRQTRRVATLAVTFHGNFNYVW 66

  Fly    72 VKISSAMWPQTSLRTGVIKAAVETISYTPGAMTCFYFIMSLLESKTVEQAVAEVGKKFLPTYKVA 136
            :::.....|..:.||.:.|...:.....|.|::.||..||:|:.|  :....::.:||..|||..
Mouse    67 LRLLERALPGRAPRTVLAKVLCDQTVGGPIALSAFYVGMSVLQGK--DDIFLDLKQKFWNTYKSG 129

  Fly   137 LSVWPLVATINFTLIPERNRVPFISACSLCWTCFLAY 173
            |..||.|...||:|:|...|..:...|:..|..||.:
Mouse   130 LMYWPFVQLTNFSLVPVHWRTAYTGLCAFLWATFLCF 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14778NP_569918.1 Mpv17_PMP22 111..172 CDD:461182 20/60 (33%)
Mpv17lNP_291042.2 Targeting to peroxisomes 16..55 10/41 (24%)
Mpv17_PMP22 106..165 CDD:461182 20/60 (33%)

Return to query results.
Submit another query.