DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14778 and SYM1

DIOPT Version :9

Sequence 1:NP_569918.1 Gene:CG14778 / 31100 FlyBaseID:FBgn0029580 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_013352.1 Gene:SYM1 / 850953 SGDID:S000004241 Length:197 Species:Saccharomyces cerevisiae


Alignment Length:168 Identity:42/168 - (25%)
Similarity:88/168 - (52%) Gaps:16/168 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GMISYSLIWPTGSLIQQTVEGRRWGTYDWWRVLRFSMYGGLFVAPTLYGWVKI-SSAMW----PQ 81
            |.:|..|::||..:.:         .||:.|..|..:||.|..:.....|.|| ::.::    ||
Yeast    30 GDVSAQLLFPTSKVNK---------GYDYKRTARAVIYGSLIFSFIGDKWYKILNNKIYMRNRPQ 85

  Fly    82 TSLRTGVIKAAVETISYTPGAMTCFYFIMSLLESKTVEQAVAEVGKKFLPTYKVALSVWPLVATI 146
            ......|::.||:.:::.|..:..::..||::|.::.:.|..::.:::.||.....:||||...|
Yeast    86 YHWSNMVLRVAVDQLAFAPLGLPFYFTCMSIMEGRSFDVAKLKIKEQWWPTLLTNWAVWPLFQAI 150

  Fly   147 NFTLIPERNRVPFISACSLCWTCFLAY--MKHLEHHEV 182
            ||:::|.::|:..::..::.|..:|:|  .|.:|..:|
Yeast   151 NFSVVPLQHRLLAVNVVAIFWNTYLSYKNSKVMEKDKV 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14778NP_569918.1 Mpv17_PMP22 112..176 CDD:282035 16/65 (25%)
SYM1NP_013352.1 Mpv17_PMP22 115..176 CDD:397992 15/60 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I2989
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I1675
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55228
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46501
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.