DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14778 and AT5G19750

DIOPT Version :9

Sequence 1:NP_569918.1 Gene:CG14778 / 31100 FlyBaseID:FBgn0029580 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_197476.1 Gene:AT5G19750 / 832095 AraportID:AT5G19750 Length:288 Species:Arabidopsis thaliana


Alignment Length:175 Identity:38/175 - (21%)
Similarity:76/175 - (43%) Gaps:6/175 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLWQNFKVFVTRYPIMRGMISYSLIWPTGSLI-QQTVEGRRWGTYDWWRVLRFSMYGGLFVAPTL 68
            |.|  ::..::..|::...::.:|:...|.|| |.|:  .:..:.|..|.|.|:..|...|.|||
plant   115 LSW--YQALLSNSPVLTKAVTAALLNLVGDLICQLTI--NKTSSLDKKRTLTFTFLGLGLVGPTL 175

  Fly    69 YGWVKISSAMWPQTSLRTGVIKAAVETISYTPGAMTCFYFIMSLLESKTVEQAVAEVGKKFLPTY 133
            :.|....|.:...:.|...||:..::...:.|..:..|...:..||.|. ...:.::.:::....
plant   176 HFWYLYLSKVVTASGLSGAVIRLLLDQFVFAPIFVGVFLSAVVTLEGKP-SNVIPKLQQEWTGAM 239

  Fly   134 KVALSVWPLVATINFTLIPERNRVPFISACSLCWTCFLAYMKHLE 178
            .....:|.....:||..:|:..:|...:..:|.|...|::..|.|
plant   240 IANWQLWIPFQFLNFRFVPQNYQVLASNVVALAWNVILSFKAHKE 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14778NP_569918.1 Mpv17_PMP22 112..176 CDD:282035 11/63 (17%)
AT5G19750NP_197476.1 LbR-like <21..>69 CDD:248061
Mpv17_PMP22 220..278 CDD:367825 10/58 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55228
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3570
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.