DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14778 and AT4G33905

DIOPT Version :9

Sequence 1:NP_569918.1 Gene:CG14778 / 31100 FlyBaseID:FBgn0029580 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_567940.1 Gene:AT4G33905 / 829534 AraportID:AT4G33905 Length:261 Species:Arabidopsis thaliana


Alignment Length:174 Identity:50/174 - (28%)
Similarity:81/174 - (46%) Gaps:4/174 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AGPLLWQNFKVFVTRYPIMRGMISYSLIWPTGSLIQQTVEGRRWGTYDWWRVLRFSMYGGLFVAP 66
            ||.:.|  :...|...|::...::.|||:....|..||:......:||..|..|...||.|.:.|
plant    80 AGFIGW--YLGMVKSRPVLTKSVTSSLIYIAADLSSQTIPQASVDSYDLVRTARMGGYGLLILGP 142

  Fly    67 TLYGWVKISSAMWPQTSLRTGVIKAAVETISYTPGAMTCFYFIMSLLESKTVEQAVAEVGKKFLP 131
            ||:.|..:.|:::|:..|.|...|.|:....|.|.....|:.:.:.|:.:...:.||.:.:..||
plant   143 TLHYWFNLMSSLFPKRDLITTFKKMAMGQTVYGPAMNVVFFSLNAALQGENGSEIVARLKRDLLP 207

  Fly   132 TYKVALSVWPLVATINFTLIPERNRVPFIS-ACSLCWTCFLAYM 174
            |....:..|||...|.|...|...: |.:| :.|..||.::.||
plant   208 TMLNGVMYWPLCDFITFKFCPVYLQ-PLVSNSFSYLWTIYITYM 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14778NP_569918.1 Mpv17_PMP22 112..176 CDD:282035 19/64 (30%)
AT4G33905NP_567940.1 Mpv17_PMP22 187..247 CDD:397992 17/60 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2313
OMA 1 1.010 - - QHG55228
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1204
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11266
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.