DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14778 and AT3G24570

DIOPT Version :9

Sequence 1:NP_569918.1 Gene:CG14778 / 31100 FlyBaseID:FBgn0029580 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_189100.1 Gene:AT3G24570 / 822053 AraportID:AT3G24570 Length:235 Species:Arabidopsis thaliana


Alignment Length:206 Identity:44/206 - (21%)
Similarity:84/206 - (40%) Gaps:37/206 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LWQNFKVFVTRYPIMRGMISYSLIWPTGSLIQQ-----TVEGR-------------------RWG 46
            ||:.::..:|.:|:...:||...:|..|.:..|     |.:.|                   :|.
plant     4 LWRWYQRCLTVHPVKTQVISSGFLWGFGDVTAQYITHSTAKRRLLRLTETNKDADADAEIKVKWK 68

  Fly    47 -----TYDWWRVLRFSMYGGLFVAPTLYGW-------VKISSAMWPQTSLRTGVIKAAVETISYT 99
                 ..:|.||...||:|..||.|..:.|       :|:.....|: |.|....|.|::.:.:.
plant    69 QDAEFKVNWKRVAITSMFGFGFVGPVGHFWYEGLDKFIKLKLRYVPK-STRFVAAKVAMDGLIFG 132

  Fly   100 PGAMTCFYFIMSLLESKTVEQAVAEVGKKFLPTYKVALSVWPLVATINFTLIPERNRVPFISACS 164
            |..:..|:..|.....|...:....:.:.|||...:....|||:...||..:|.:.::.:::...
plant   133 PVDLLVFFTYMGFATGKNTAEVKEGLKRDFLPALALEGGAWPLLQIANFRYVPVQYQLLYVNIFC 197

  Fly   165 LCWTCFLAYMK 175
            |..:.||::::
plant   198 LVDSAFLSWVE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14778NP_569918.1 Mpv17_PMP22 112..176 CDD:282035 13/64 (20%)
AT3G24570NP_189100.1 Mpv17_PMP22 144..205 CDD:397992 12/60 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.