DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14778 and AT2G42770

DIOPT Version :9

Sequence 1:NP_569918.1 Gene:CG14778 / 31100 FlyBaseID:FBgn0029580 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_565983.1 Gene:AT2G42770 / 818877 AraportID:AT2G42770 Length:232 Species:Arabidopsis thaliana


Alignment Length:181 Identity:46/181 - (25%)
Similarity:76/181 - (41%) Gaps:30/181 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RYPIMRGMISYSLIWPTGSLIQQTV-----------------EGRRWGTY---DWWRVLRFSMYG 60
            |:|:.:.:.:.:|.: ||..|.|..                 ||..|..:   ||.|.||.|.||
plant    53 RFPLKQAVTAGALTF-TGDTIAQLSGRWKKRTALKQSSSELDEGELWNIFSEHDWIRALRMSSYG 116

  Fly    61 GLFVAPTLYGWVKISSAMWPQTSLRTGVIKAAVETISYTPGAMTCFYFIMSLLESKTVEQAVAEV 125
            .|...|..|.|.:......|:.:....|:|..:..:...|..:...:...:|...|     ::|:
plant   117 FLLYGPGSYAWYQFLDHSLPKPTATNLVLKVLLNQVILGPSVIAVIFAWNNLWLGK-----LSEL 176

  Fly   126 GKKF----LPTYKVALSVWPLVATINFTLIPERNRVPFISACSLCWTCFLA 172
            |.|:    |||.......|..|:.:||.::|.:.||.|:|..|:.|..:|:
plant   177 GNKYQKDALPTLLYGFRFWVPVSILNFWVVPLQARVAFMSMGSVFWNFYLS 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14778NP_569918.1 Mpv17_PMP22 112..176 CDD:282035 20/65 (31%)
AT2G42770NP_565983.1 Mpv17_PMP22 173..227 CDD:397992 17/53 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11266
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.