DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14778 and AT2G14860

DIOPT Version :9

Sequence 1:NP_569918.1 Gene:CG14778 / 31100 FlyBaseID:FBgn0029580 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_179092.1 Gene:AT2G14860 / 815975 AraportID:AT2G14860 Length:252 Species:Arabidopsis thaliana


Alignment Length:166 Identity:45/166 - (27%)
Similarity:74/166 - (44%) Gaps:2/166 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VTRYPIMRGMISYSLIWPTGSLIQQTVEGRRWGTYDWWRVLRFSMYGGLFVAPTLYGWVKISSAM 78
            |..:|::...::.|||:....|..||:......:||..|..|...||...:.|||:.|....|.:
plant    81 VKSHPVVTKSVTSSLIYIAADLSSQTIAKTSSESYDLVRTARMGGYGLFVLGPTLHYWFNFMSRL 145

  Fly    79 WPQTSLRTGVIKAAVETISYTPGAMTCFYFIMSLLESKTVEQAVAEVGKKFLPTYKVALSVWPLV 143
            :|:..|.|...|.|:....|.|.....|:.:.:.|:.:.....:|.:.:..||.....:..|||.
plant   146 FPKQDLITTFKKMAMGQTIYGPIMTVIFFSLNASLQGERGSVILARLKRDLLPALFNGVMYWPLC 210

  Fly   144 ATINFTLIPERNRVPFIS-ACSLCWTCFLAYMKHLE 178
            ..|.|...|...: |.:| :.|..||.::.||.:.|
plant   211 DFITFRFFPVHLQ-PLVSNSFSYVWTIYMTYMANRE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14778NP_569918.1 Mpv17_PMP22 112..176 CDD:282035 17/64 (27%)
AT2G14860NP_179092.1 Mpv17_PMP22 180..243 CDD:282035 17/63 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2313
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1204
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11266
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.920

Return to query results.
Submit another query.