DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14778 and PXMP2

DIOPT Version :9

Sequence 1:NP_569918.1 Gene:CG14778 / 31100 FlyBaseID:FBgn0029580 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_061133.1 Gene:PXMP2 / 5827 HGNCID:9716 Length:195 Species:Homo sapiens


Alignment Length:174 Identity:40/174 - (22%)
Similarity:78/174 - (44%) Gaps:18/174 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FKVFVTRYPIMRGMISYSLIWPTGSLIQQTVEGRR----WGTYDWWRVLRFSMYGGLFVAPT--- 67
            :.:|:..||::....:..::...|:.:.|.:|.:|    ..:.|....||:::||..|..|.   
Human    25 YLLFLRLYPVLTKAATSGILSALGNFLAQMIEKKRKKENSRSLDVGGPLRYAVYGFFFTGPLSHF 89

  Fly    68 ----LYGWVKISSAMWPQTSLRTGVIKAAVETISYTPGAMTCFYFIMSLLESKTVEQAVAEVGKK 128
                :..|:.      |:..| .|:.:..::.:.:.|..:..|:.||:.||.|......|::...
Human    90 FYFFMEHWIP------PEVPL-AGLRRLLLDRLVFAPAFLMLFFLIMNFLEGKDASAFAAKMRGG 147

  Fly   129 FLPTYKVALSVWPLVATINFTLIPERNRVPFISACSLCWTCFLA 172
            |.|..::...||..:..||...:|.:.||.|.:..:|.|..:||
Human   148 FWPALRMNWRVWTPLQFININYVPLKFRVLFANLAALFWYAYLA 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14778NP_569918.1 Mpv17_PMP22 112..176 CDD:282035 18/61 (30%)
PXMP2NP_061133.1 Mpv17_PMP22 131..193 CDD:282035 18/61 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.