DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14778 and mpv17l

DIOPT Version :9

Sequence 1:NP_569918.1 Gene:CG14778 / 31100 FlyBaseID:FBgn0029580 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_691639.1 Gene:mpv17l / 563178 ZFINID:ZDB-GENE-120215-229 Length:199 Species:Danio rerio


Alignment Length:158 Identity:39/158 - (24%)
Similarity:65/158 - (41%) Gaps:4/158 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PIMRGMISYSLIWPTGSLIQQTVEGRRWGTYDWWRVLRFSMYGGLFVAPTLYGWVKISSAMWPQT 82
            |.:..:..|..::..|..:.|.:..|  ...||......::....|.....|.|::...:.:|..
Zfish    16 PWISNVTLYGCLFAGGDFVHQCIAQR--DEMDWRHTRNVAIVALSFQGNFNYFWLRALESRFPGR 78

  Fly    83 SLRTGVIKAAVETISYTPGAMTCFYFIMSLLESKTVEQAVAEVGKKFLPTYKVALSVWPLVATIN 147
            |......|..::....:|.|.:.||..:|.||.|  |....:..:||..|||..|..||.:..:|
Zfish    79 SAGMVFRKLVLDQSFASPLATSVFYTGVSFLEGK--EDIFEDWREKFFNTYKTGLMYWPFMQFLN 141

  Fly   148 FTLIPERNRVPFISACSLCWTCFLAYMK 175
            |.|:|...|..|:...:..|..||.:.:
Zfish   142 FVLMPLYLRTAFMGCSAFVWATFLCFSR 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14778NP_569918.1 Mpv17_PMP22 112..176 CDD:282035 21/64 (33%)
mpv17lXP_691639.1 Mpv17_PMP22 108..167 CDD:282035 21/60 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591902
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002289
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1515
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.