DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14778 and mpv17l2

DIOPT Version :9

Sequence 1:NP_569918.1 Gene:CG14778 / 31100 FlyBaseID:FBgn0029580 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001004930.1 Gene:mpv17l2 / 448319 XenbaseID:XB-GENE-1002324 Length:222 Species:Xenopus tropicalis


Alignment Length:184 Identity:50/184 - (27%)
Similarity:90/184 - (48%) Gaps:9/184 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WQNFKVFVTRYPIMRGMISYSLIWPTGSLIQQTVEGRR--WGTYDWWRVLR-FSMYGGLFVAPTL 68
            |:.|  |..|:.|:...:|..|:...|..|||:.|.||  ....||.|..| |::  |..:.|.:
 Frog    16 WKPF--FKGRFLIVTNTVSCGLLLGIGDSIQQSREVRRDPERKRDWLRTGRMFAI--GCSMGPLM 76

  Fly    69 YGWVKISSAMWPQTSLRTGVIKAAVETISYTPGAMTCFYFI-MSLLESKTVEQAVAEVGKKFLPT 132
            :.|.......:|...:...:.|..::.:..:| .:..:||: |..:|.:.:|::..|..:||...
 Frog    77 HFWYSWLDRSFPGRGITVVMRKVLIDQLVASP-VLGLWYFLGMGSMEGQKLEKSWQEFREKFWEF 140

  Fly   133 YKVALSVWPLVATINFTLIPERNRVPFISACSLCWTCFLAYMKHLEHHEVDGAI 186
            ||...:|||....|||..:..:.||.:|:..::.|..:|:|:||.:...|:..:
 Frog   141 YKADWTVWPAAQMINFYFLSPKYRVIYINVITVGWDTYLSYLKHRKEECVENTM 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14778NP_569918.1 Mpv17_PMP22 112..176 CDD:282035 19/63 (30%)
mpv17l2NP_001004930.1 Mpv17_PMP22 119..180 CDD:367825 17/60 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.