DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14778 and CG32262

DIOPT Version :9

Sequence 1:NP_569918.1 Gene:CG14778 / 31100 FlyBaseID:FBgn0029580 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_647831.1 Gene:CG32262 / 38445 FlyBaseID:FBgn0052262 Length:273 Species:Drosophila melanogaster


Alignment Length:184 Identity:43/184 - (23%)
Similarity:80/184 - (43%) Gaps:24/184 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLWQNFKVFVTRYPIMRGMISYSLIWPTGSLIQQTVEGRR----WGTYDWWRVLRFSMYGGLFVA 65
            :.|.|   ...:|.::..::...|:...|.:|.|..|.||    ...:|..|:.|      :|||
  Fly    67 IAWSN---MFGKYLLVTNVVGSGLLMVVGDVIAQEYEYRRGLRHQDRFDTDRMYR------MFVA 122

  Fly    66 PTL--------YGWVKISSAMWPQTSLRTGVIKAAVETISYTPGAMTCFYFIMSLLESKTVEQAV 122
            ..|        |.|:   ..:.|..:|:....|..::.:..:|..:..|::.:..||.:|::...
  Fly   123 GALQGPLHHYVYNWM---DRVMPARTLKNIFKKILIDQLVMSPACIVIFFYSLCYLERQTLDATN 184

  Fly   123 AEVGKKFLPTYKVALSVWPLVATINFTLIPERNRVPFISACSLCWTCFLAYMKH 176
            .|:..||...|.:....||....:||..:..:.||.|::.|:..:...::||||
  Fly   185 QELISKFPYVYMLDWMTWPAAQYLNFRYLDTKYRVTFVNVCTAVYNVLMSYMKH 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14778NP_569918.1 Mpv17_PMP22 112..176 CDD:282035 17/63 (27%)
CG32262NP_647831.1 Mpv17_PMP22 175..238 CDD:282035 17/62 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463140
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.