DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14778 and T18D3.9

DIOPT Version :9

Sequence 1:NP_569918.1 Gene:CG14778 / 31100 FlyBaseID:FBgn0029580 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001024916.1 Gene:T18D3.9 / 3564939 WormBaseID:WBGene00011826 Length:181 Species:Caenorhabditis elegans


Alignment Length:177 Identity:44/177 - (24%)
Similarity:78/177 - (44%) Gaps:10/177 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VFVTR----YPIMRGMISYSLIWPTGS-LIQQTVEGRRWGTYDWWRVLRFSMYGGLFVAPTLYGW 71
            :|:.|    .|:...|.....|..:|. |.|.....:.|   |.||..|||.....|:||:|:.|
 Worm     5 LFIRRRLATNPLSTQMCIAGTISGSGDCLAQYLSHNQEW---DRWRTARFSFLSSCFMAPSLFIW 66

  Fly    72 VKISSAMWPQTSLRTGVIKAAVETISYTPGAMTCFYFIMSLLESKTVEQAVAEVGKKFLPTYKVA 136
            .::...:.........|.|..::.:.::|.......|.:.||:.::.|::...:.:.:...|..:
 Worm    67 FRLLEKVKGNNKSLLLVKKLCIDQLCFSPCFNAAILFNLRLLQHQSAEKSWDLLKEDWFNIYATS 131

  Fly   137 LSVWPLVATINFTLIPERNRVPFISACSLCWTCFLAYM--KHLEHHE 181
            |.|||.|..:|...:|...||......:..|.|:|:|:  |.::|.|
 Worm   132 LKVWPFVQVVNLCFVPLNYRVILNQVVAFFWNCYLSYITQKPIDHIE 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14778NP_569918.1 Mpv17_PMP22 112..176 CDD:282035 17/65 (26%)
T18D3.9NP_001024916.1 Mpv17_PMP22 107..171 CDD:282035 17/63 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55228
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.