DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14778 and CG14777

DIOPT Version :9

Sequence 1:NP_569918.1 Gene:CG14778 / 31100 FlyBaseID:FBgn0029580 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001162634.1 Gene:CG14777 / 31099 FlyBaseID:FBgn0026872 Length:196 Species:Drosophila melanogaster


Alignment Length:165 Identity:97/165 - (58%)
Similarity:126/165 - (76%) Gaps:2/165 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YPIMRGMISYSLIWPTGSLIQQTVEGRRWGTYDWWRVLRFSMYGGLFVAPTLYGWVKISSAMWPQ 81
            :|:.:|.::|:::||.||||||.:|||:...|||.|.||||::|.|:|||||||||:::||||||
  Fly    23 HPMAKGALTYAVMWPAGSLIQQAMEGRKLREYDWARALRFSLFGALYVAPTLYGWVRLTSAMWPQ 87

  Fly    82 TSLRTGVIKAAVETISYTPGAMTCFYFIMSLLESKTVEQAVAEVGKKFLPTYKVALSVWPLVATI 146
            |:||||::||..|.:||.|.|...|:..|||||.||..|||.|..:|..|||||.:.:||::.||
  Fly    88 TNLRTGIVKAITEQLSYGPFACVSFFMGMSLLELKTFSQAVEETKEKAAPTYKVGVCIWPILQTI 152

  Fly   147 NFTLIPERNRVPFISACSLCWTCFLAYMKHLEHHE 181
            ||:|:||.|||.|:|.|||.||.||||||  .|||
  Fly   153 NFSLVPEHNRVVFVSICSLMWTIFLAYMK--THHE 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14778NP_569918.1 Mpv17_PMP22 112..176 CDD:282035 39/63 (62%)
CG14777NP_001162634.1 Mpv17_PMP22 118..181 CDD:282035 38/62 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443435
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2313
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D114127at33392
OrthoFinder 1 1.000 - - FOG0002289
OrthoInspector 1 1.000 - - mtm1204
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1515
109.900

Return to query results.
Submit another query.