DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14778 and Mpv17l2

DIOPT Version :9

Sequence 1:NP_569918.1 Gene:CG14778 / 31100 FlyBaseID:FBgn0029580 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_008769309.1 Gene:Mpv17l2 / 290645 RGDID:1308064 Length:206 Species:Rattus norvegicus


Alignment Length:194 Identity:52/194 - (26%)
Similarity:87/194 - (44%) Gaps:28/194 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AGPLLWQNFKVFVTRYPIMRG---MISYSLIWPTG-SLIQQTVEGRRWGTYDWWRV-----LRF- 56
            ||...|.. |......|:.:|   :::.:|    | .::..|.:|.|..    |.|     .|| 
  Rat     3 AGGWRWAR-KALAAGRPLFQGRALLVTNTL----GCGVLMATGDGARQA----WEVRARPEQRFS 58

  Fly    57 -----SMYG-GLFVAPTLYGWVKISSAMWPQTSLRT--GVIKAAVETISYTPGAMTCFYFI-MSL 112
                 ||:. |..:.|.|:.|......:.|.:.||:  .|:|..:...:.....:..:||: :..
  Rat    59 ARRSASMFAVGCSMGPFLHFWYLWLDRLLPASGLRSLPSVMKKVLVDQTVASPILGVWYFLGLGS 123

  Fly   113 LESKTVEQAVAEVGKKFLPTYKVALSVWPLVATINFTLIPERNRVPFISACSLCWTCFLAYMKH 176
            ||.:|:|::..|:..||...||....|||....:||..||...||.:|:..:|.|..:|:|:|:
  Rat   124 LEGQTLEESCQELRAKFWDFYKADWCVWPAAQLVNFLFIPSHFRVTYINGLTLGWDTYLSYLKY 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14778NP_569918.1 Mpv17_PMP22 112..176 CDD:282035 23/63 (37%)
Mpv17l2XP_008769309.1 Mpv17_PMP22 124..186 CDD:282035 23/61 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.