DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14778 and CG12355

DIOPT Version :9

Sequence 1:NP_569918.1 Gene:CG14778 / 31100 FlyBaseID:FBgn0029580 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001097610.1 Gene:CG12355 / 2768954 FlyBaseID:FBgn0040805 Length:204 Species:Drosophila melanogaster


Alignment Length:167 Identity:47/167 - (28%)
Similarity:75/167 - (44%) Gaps:10/167 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RYPIMRGMISYSLIWPTGSLIQQTVEGRRW-------GTYDWWRVLRFSMYGGLFVAPTLYGWVK 73
            |||.:.....|..:: .|:...|....:||       ...|:..:.|:::.|....|||||.|.|
  Fly    14 RYPFVTNSAIYGSLY-VGAEYSQQFASKRWLATASKPEDIDYATIGRYAVMGTAVYAPTLYLWYK 77

  Fly    74 ISSAMWPQTSLRTGVIKAAVETISYTPGAMTCFYFIMSLLESKTVEQAVAEVGKKFLPTYKVALS 138
            .....:|.|:....|.|..::....||..:|.||..||::|...  ....|:.:||:||:..:..
  Fly    78 WLDRAFPGTTKVIIVKKLVLDQFVLTPYLLTVFYAGMSIMEGSA--DIFLELREKFVPTFMRSCI 140

  Fly   139 VWPLVATINFTLIPERNRVPFISACSLCWTCFLAYMK 175
            .|.....:||:|:..|.||.::..|.|.|...|.:.|
  Fly   141 FWLPAQALNFSLVAPRFRVIYMGICGLIWVNILCWTK 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14778NP_569918.1 Mpv17_PMP22 112..176 CDD:282035 18/64 (28%)
CG12355NP_001097610.1 Mpv17_PMP22 116..178 CDD:282035 18/64 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1301408at2759
OrthoFinder 1 1.000 - - FOG0002289
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1515
65.920

Return to query results.
Submit another query.