DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14778 and MPV17L

DIOPT Version :9

Sequence 1:NP_569918.1 Gene:CG14778 / 31100 FlyBaseID:FBgn0029580 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_016878597.1 Gene:MPV17L / 255027 HGNCID:26827 Length:198 Species:Homo sapiens


Alignment Length:121 Identity:27/121 - (22%)
Similarity:49/121 - (40%) Gaps:10/121 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGPLLWQNFKVFVTRYPIMRGMISYSLIWPTGSLIQQTVEGRRWGTYDWWRVLRFSMYGGLFVA 65
            |||  .|........|:|....::.|..:...|..:||.::||.   .:|.:..|.:.....|.|
Human    85 MAG--WWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGRE---ANWRQTRRVATLVVTFHA 144

  Fly    66 PTLYGWVKISSAMWPQTSLRTGVIKAAVETISYTPGAMTCFYFIMSLLESKTVEQA 121
            ...|.|:::.....|..:....:.|...:.:...|.|::.||     :.|.::.||
Human   145 NFNYVWLRLLERALPGRAPHALLAKLLCDQVVGAPIAVSAFY-----VGSHSIPQA 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14778NP_569918.1 Mpv17_PMP22 112..176 CDD:282035 3/10 (30%)
MPV17LXP_016878597.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156289
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1301408at2759
OrthoFinder 1 1.000 - - FOG0002289
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1515
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.