DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14778 and Pxmp2

DIOPT Version :9

Sequence 1:NP_569918.1 Gene:CG14778 / 31100 FlyBaseID:FBgn0029580 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_033019.2 Gene:Pxmp2 / 19301 MGIID:107487 Length:193 Species:Mus musculus


Alignment Length:160 Identity:44/160 - (27%)
Similarity:84/160 - (52%) Gaps:6/160 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YPIMRGMISYSLIWPTGSLIQQTVEGRRWGT--YDWWRVLRFSMYGGLFVAPTL--YGWVKISSA 77
            ||::...:|..::...|:|:.||:|.|:..:  .:...:||:.:| ||||...|  |.::.:..:
Mouse    32 YPVLTKAVSSGILSALGNLLAQTIEKRKKDSQNLEVSGLLRYLVY-GLFVTGPLSHYLYLFMEYS 95

  Fly    78 MWPQTSLRTGVIKAAVETISYTPGAMTCFYFIMSLLESKTVEQAVAEVGKKFLPTYKVALSVWPL 142
            :.|:... ..|.:..::.:.:.|..:..|:|:|:|||.|.|...||::...|.|..::...:|..
Mouse    96 VPPEVPW-ASVKRLLLDRLFFAPTFLLLFFFVMNLLEGKNVSVFVAKMRSGFWPALQMNWRMWTP 159

  Fly   143 VATINFTLIPERNRVPFISACSLCWTCFLA 172
            :..||...:|.:.||.|.:..:|.|..:||
Mouse   160 LQFININYVPLQFRVLFANMAALFWYAYLA 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14778NP_569918.1 Mpv17_PMP22 112..176 CDD:282035 20/61 (33%)
Pxmp2NP_033019.2 Mpv17_PMP22 129..191 CDD:282035 20/61 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.