DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14778 and ZK470.1

DIOPT Version :9

Sequence 1:NP_569918.1 Gene:CG14778 / 31100 FlyBaseID:FBgn0029580 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_508708.3 Gene:ZK470.1 / 191323 WormBaseID:WBGene00022744 Length:180 Species:Caenorhabditis elegans


Alignment Length:156 Identity:46/156 - (29%)
Similarity:77/156 - (49%) Gaps:6/156 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TGSLIQQTVEG--RRWGTYDWWRVLRFSMYGGLFVAPTLYGWVKISSAMWPQTSLRTGVIKAAVE 94
            |..:|||.:.|  .|.| :||.|..|.:.. ||.:||:|:.:.::........|....|:|....
 Worm    27 TADIIQQHINGDVDRDG-WDWRRTCRMAAI-GLVMAPSLHCFYRVLDTRKFIGSRNCKVLKKLAW 89

  Fly    95 TISYTPGAMTCFYFIMSLLESKTVEQAVAEVGKKFLPTYKVALSVWPLVATINFTLIPERNRVPF 159
            ..::.|.....|..:.|:.|.|::..|.||..:|....:||..::||....|||..:|...||.:
 Worm    90 DTAFIPYFSCIFMTVGSIYEGKSLSAAFAEYRRKMWHIWKVDFTLWPPAQLINFYFMPPALRVVY 154

  Fly   160 ISACSLCWTCFLAYMKH--LEHHEVD 183
            ::..||.:.|.::|:|:  |.||..:
 Worm   155 VNLVSLLYNCIMSYIKNNELHHHSTN 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14778NP_569918.1 Mpv17_PMP22 112..176 CDD:282035 20/63 (32%)
ZK470.1NP_508708.3 Nuc-transf <27..>54 CDD:294849 11/27 (41%)
Mpv17_PMP22 109..171 CDD:282035 20/61 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.