DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14778 and Mpv17l

DIOPT Version :9

Sequence 1:NP_569918.1 Gene:CG14778 / 31100 FlyBaseID:FBgn0029580 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_008765688.1 Gene:Mpv17l / 100362572 RGDID:2324483 Length:194 Species:Rattus norvegicus


Alignment Length:180 Identity:49/180 - (27%)
Similarity:78/180 - (43%) Gaps:9/180 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WQNFKVFVTRYPIMRGMISYSLIWPTGSLIQQTVEGRRWGTYDWWRVLRFSMYGGLFVAPTLYGW 71
            |:.|.....|||....::.|:.::..|..:||.:.|   |..||.:..|.:.....|.....|.|
  Rat     5 WRAFPRAARRYPWPTNVLLYAGLFSAGDALQQRLRG---GPADWRQTRRVATLALTFHGNFNYMW 66

  Fly    72 VKISSAMWPQTSLRTGVIKAAVETISYTPGAMTCFYFIMSLLESKTVEQAVAEVGKKFLPTYKVA 136
            :::.....|..:.||.:.|...:.....|.|::.||..||:|:.|  :....::.:||..|||..
  Rat    67 LRLLERALPGRAPRTVLAKVLCDQTVGGPVALSAFYVGMSILQGK--DDIFLDLRQKFWNTYKTG 129

  Fly   137 LSVWPLVATINFTLIPERNRVPFISACSLCWTCFLAYMKHLEHHEVDGAI 186
            |..||.|...||:|:|...|..:...|...|..||.:    .....||.:
  Rat   130 LMYWPFVQLTNFSLVPVNWRTAYTGLCGFLWATFLCF----SQQSGDGTV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14778NP_569918.1 Mpv17_PMP22 112..176 CDD:282035 20/63 (32%)
Mpv17lXP_008765688.1 Mpv17_PMP22 106..165 CDD:397992 20/60 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350227
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1301408at2759
OrthoFinder 1 1.000 - - FOG0002289
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11266
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1515
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.