DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MNX1 and zen2

DIOPT Version :9

Sequence 1:NP_005506.3 Gene:MNX1 / 3110 HGNCID:4979 Length:401 Species:Homo sapiens
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:86 Identity:42/86 - (48%)
Similarity:56/86 - (65%) Gaps:13/86 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   240 KCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAK- 303
            |.:|.||||:|.||:|||.:|.|||||:|.:|.|::..|.|||.||||||||||||.|:|...| 
  Fly    42 KSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKG 106

Human   304 ------------EQAAQEAEK 312
                        .|::::.:|
  Fly   107 AIGALTTSIPLSSQSSEDLQK 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MNX1NP_005506.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..78
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..120
Homeobox 244..297 CDD:278475 35/52 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..401 4/27 (15%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 35/52 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.