DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14777 and Mpv17l

DIOPT Version :9

Sequence 1:NP_001162634.1 Gene:CG14777 / 31099 FlyBaseID:FBgn0026872 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_291042.2 Gene:Mpv17l / 93734 MGIID:2135951 Length:194 Species:Mus musculus


Alignment Length:181 Identity:56/181 - (30%)
Similarity:86/181 - (47%) Gaps:13/181 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 WR---RGSKLHPMAKGALTYAVMWPAGSLIQQAMEGRKLREYDWARALRFSLFGALYVAPTLYGW 77
            ||   :.::.:|.....|.||.::.||..:||.:.|...   ||.:..|.:.....:.....|.|
Mouse     5 WRAFPQAARRYPWPTNVLLYAGLFSAGDALQQRLRGGPA---DWRQTRRVATLAVTFHGNFNYVW 66

  Fly    78 VRLTSAMWPQTNLRTGIVKAITEQLSYGPFACVSFFMGMSLLELKTFSQAVEETKEKAAPTYKVG 142
            :||.....|....||.:.|.:.:|...||.|..:|::|||:|:.|  .....:.|:|...|||.|
Mouse    67 LRLLERALPGRAPRTVLAKVLCDQTVGGPIALSAFYVGMSVLQGK--DDIFLDLKQKFWNTYKSG 129

  Fly   143 VCIWPILQTINFSLVPEHNRVVFVSICSLMWTIFLAYMKTHHEEQSNSAVL 193
            :..||.:|..||||||.|.|..:..:|:.:|..||.:     .:||....|
Mouse   130 LMYWPFVQLTNFSLVPVHWRTAYTGLCAFLWATFLCF-----SQQSGDGTL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14777NP_001162634.1 Mpv17_PMP22 118..181 CDD:282035 23/62 (37%)
Mpv17lNP_291042.2 Targeting to peroxisomes 16..55 12/41 (29%)
Mpv17_PMP22 107..166 CDD:282035 23/60 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846700
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1301408at2759
OrthoFinder 1 1.000 - - FOG0002289
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11266
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5861
SonicParanoid 1 1.000 - - X1515
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.840

Return to query results.
Submit another query.