DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14777 and YOR292C

DIOPT Version :9

Sequence 1:NP_001162634.1 Gene:CG14777 / 31099 FlyBaseID:FBgn0026872 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_014935.3 Gene:YOR292C / 854467 SGDID:S000005818 Length:309 Species:Saccharomyces cerevisiae


Alignment Length:136 Identity:30/136 - (22%)
Similarity:56/136 - (41%) Gaps:24/136 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 YDWARALRFSLFGALYVAPTLYGWVRLTSAMWPQTNLRTGIV-KAITEQLSYGPFACVSFFMGMS 117
            :.|...:.:..|.:.:.||    |.:..:..:.:......:. :.:::||.|.|.:...|||   
Yeast   181 FRWGCFMFWGFFISFFQAP----WYKFLNFFYTEDPTVVQVFERVLSDQLLYSPISLYCFFM--- 238

  Fly   118 LLELKTFSQAVEETKEKAAPTYKV----------GVCIWPILQTINFSLVPEHNRVVFVSICSLM 172
                  ||..|.|..:|.....|:          ...:||::|.|||.::|...:..|.|...::
Yeast   239 ------FSNYVMEGGDKDTLGKKIQRLYISTLGCNYLVWPMVQFINFLIMPRDFQAPFSSSVGVV 297

  Fly   173 WTIFLA 178
            |..||:
Yeast   298 WNCFLS 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14777NP_001162634.1 Mpv17_PMP22 118..181 CDD:282035 18/71 (25%)
YOR292CNP_014935.3 Mpv17_PMP22 243..303 CDD:397992 15/59 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.