DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14777 and SYM1

DIOPT Version :9

Sequence 1:NP_001162634.1 Gene:CG14777 / 31099 FlyBaseID:FBgn0026872 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_013352.1 Gene:SYM1 / 850953 SGDID:S000004241 Length:197 Species:Saccharomyces cerevisiae


Alignment Length:193 Identity:49/193 - (25%)
Similarity:93/193 - (48%) Gaps:22/193 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLQASLGQWRRGSKLHPMAKGALTYAVMWPAGSLIQQAM--EGRKLREYDWARALRFSLFGALYV 70
            |.:|||       |..|....|:....::..|.:..|.:  ..:..:.||:.|..|..::|:|..
Yeast     6 LYEASL-------KRRPKTTNAIMTGALFGIGDVSAQLLFPTSKVNKGYDYKRTARAVIYGSLIF 63

  Fly    71 APTLYGWVR-LTSAMW----PQTNLRTGIVKAITEQLSYGPFACVSFFMGMSLLELKTFSQAVEE 130
            :.....|.: |.:.::    ||.:....:::...:||::.|.....:|..||::|.::|..|..:
Yeast    64 SFIGDKWYKILNNKIYMRNRPQYHWSNMVLRVAVDQLAFAPLGLPFYFTCMSIMEGRSFDVAKLK 128

  Fly   131 TKEKAAPTYKVGVCIWPILQTINFSLVPEHNRVVFVSICSLMWTIFLAYMKTHHEEQSNSAVL 193
            .||:..||......:||:.|.||||:||..:|::.|::.::.|..:|:|        .||.|:
Yeast   129 IKEQWWPTLLTNWAVWPLFQAINFSVVPLQHRLLAVNVVAIFWNTYLSY--------KNSKVM 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14777NP_001162634.1 Mpv17_PMP22 118..181 CDD:282035 21/62 (34%)
SYM1NP_013352.1 Mpv17_PMP22 115..176 CDD:397992 20/60 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I2989
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I1675
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55228
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46501
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.