DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14777 and AT5G19750

DIOPT Version :9

Sequence 1:NP_001162634.1 Gene:CG14777 / 31099 FlyBaseID:FBgn0026872 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_197476.1 Gene:AT5G19750 / 832095 AraportID:AT5G19750 Length:288 Species:Arabidopsis thaliana


Alignment Length:162 Identity:41/162 - (25%)
Similarity:74/162 - (45%) Gaps:3/162 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PMAKGALTYAVMWPAGSLIQQAMEGRKLREYDWARALRFSLFGALYVAPTLYGWVRLTSAMWPQT 88
            |:...|:|.|::...|.||.| :...|....|..|.|.|:..|...|.|||:.|....|.:...:
plant   126 PVLTKAVTAALLNLVGDLICQ-LTINKTSSLDKKRTLTFTFLGLGLVGPTLHFWYLYLSKVVTAS 189

  Fly    89 NLRTGIVKAITEQLSYGPFACVSFFMGMSLLELKTFSQAVEETKEKAAPTYKVGVCIWPILQTIN 153
            .|...:::.:.:|..:.|.....|...:..||.|. |..:.:.:::..........:|...|.:|
plant   190 GLSGAVIRLLLDQFVFAPIFVGVFLSAVVTLEGKP-SNVIPKLQQEWTGAMIANWQLWIPFQFLN 253

  Fly   154 FSLVPEHNRVVFVSICSLMWTIFLAYMKTHHE 185
            |..||::.:|:..::.:|.|.:.|:: |.|.|
plant   254 FRFVPQNYQVLASNVVALAWNVILSF-KAHKE 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14777NP_001162634.1 Mpv17_PMP22 118..181 CDD:282035 14/62 (23%)
AT5G19750NP_197476.1 LbR-like <21..>69 CDD:248061
Mpv17_PMP22 220..278 CDD:367825 13/58 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55228
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3570
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.