DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14777 and AT2G14860

DIOPT Version :9

Sequence 1:NP_001162634.1 Gene:CG14777 / 31099 FlyBaseID:FBgn0026872 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_179092.1 Gene:AT2G14860 / 815975 AraportID:AT2G14860 Length:252 Species:Arabidopsis thaliana


Alignment Length:166 Identity:48/166 - (28%)
Similarity:74/166 - (44%) Gaps:1/166 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 WRRGS-KLHPMAKGALTYAVMWPAGSLIQQAMEGRKLREYDWARALRFSLFGALYVAPTLYGWVR 79
            |..|. |.||:...::|.::::.|..|..|.:.......||..|..|...:|...:.|||:.|..
plant    76 WYLGMVKSHPVVTKSVTSSLIYIAADLSSQTIAKTSSESYDLVRTARMGGYGLFVLGPTLHYWFN 140

  Fly    80 LTSAMWPQTNLRTGIVKAITEQLSYGPFACVSFFMGMSLLELKTFSQAVEETKEKAAPTYKVGVC 144
            ..|.::|:.:|.|...|....|..|||...|.||...:.|:.:..|..:...|....|....||.
plant   141 FMSRLFPKQDLITTFKKMAMGQTIYGPIMTVIFFSLNASLQGERGSVILARLKRDLLPALFNGVM 205

  Fly   145 IWPILQTINFSLVPEHNRVVFVSICSLMWTIFLAYM 180
            .||:...|.|...|.|.:.:..:..|.:|||::.||
plant   206 YWPLCDFITFRFFPVHLQPLVSNSFSYVWTIYMTYM 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14777NP_001162634.1 Mpv17_PMP22 118..181 CDD:282035 18/63 (29%)
AT2G14860NP_179092.1 Mpv17_PMP22 180..243 CDD:282035 18/62 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2313
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1204
orthoMCL 1 0.900 - - OOG6_120807
Panther 1 1.100 - - O PTHR11266
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.820

Return to query results.
Submit another query.