DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14777 and AT4G14301

DIOPT Version :10

Sequence 1:NP_569917.1 Gene:CG14777 / 31099 FlyBaseID:FBgn0026872 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001154231.1 Gene:AT4G14301 / 6240440 AraportID:AT4G14301 Length:132 Species:Arabidopsis thaliana


Alignment Length:33 Identity:11/33 - (33%)
Similarity:15/33 - (45%) Gaps:8/33 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GSLIQQAMEGRKLREYDWARALRFSLFGALYVA 71
            |||:   :.|..|....|     |::|...|||
plant     2 GSLV---VNGAALLALLW-----FNVFVVNYVA 26

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14777NP_569917.1 Mpv17_PMP22 117..178 CDD:461182
AT4G14301NP_001154231.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.