Sequence 1: | NP_001162634.1 | Gene: | CG14777 / 31099 | FlyBaseID: | FBgn0026872 | Length: | 196 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_061133.1 | Gene: | PXMP2 / 5827 | HGNCID: | 9716 | Length: | 195 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 50/198 - (25%) |
---|---|---|---|
Similarity: | 92/198 - (46%) | Gaps: | 27/198 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MVPAAVKL-LQASLGQWRRGS--------KLHPMAKGALTYAVMWPAGSLIQQAMEGRKLRE--- 53
Fly 54 -YDWARALRFSLFGALYVAPT-------LYGWVRLTSAMWPQTNLRTGIVKAITEQLSYGPFACV 110
Fly 111 SFFMGMSLLELKTFSQAVEETKEKAAPTYKVGVCIWPILQTINFSLVPEHNRVVFVSICSLMWTI 175
Fly 176 FLA 178 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14777 | NP_001162634.1 | Mpv17_PMP22 | 118..181 | CDD:282035 | 19/61 (31%) |
PXMP2 | NP_061133.1 | Mpv17_PMP22 | 131..193 | CDD:282035 | 19/61 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1944 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |