DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14777 and si:ch211-120k19.1

DIOPT Version :9

Sequence 1:NP_001162634.1 Gene:CG14777 / 31099 FlyBaseID:FBgn0026872 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001313499.1 Gene:si:ch211-120k19.1 / 563199 ZFINID:ZDB-GENE-100922-282 Length:231 Species:Danio rerio


Alignment Length:217 Identity:57/217 - (26%)
Similarity:82/217 - (37%) Gaps:58/217 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KLHPMAKGALTYAVMWPAGSLIQQAMEGR------------------------------------ 49
            |.||.....:.|..::....||||.:.|:                                    
Zfish     9 KSHPYIPNVVGYTTLFATADLIQQGVMGKAQDKETEQEVQDTLKTSIERFTVSKEGKTDDLTLYN 73

  Fly    50 ---------KLRE-----------YDWARALRFSLFGALYVAPTLYGWVRLTSAMWPQTNLRTGI 94
                     .|.|           .||::..|.:|.|..:.|...|.|:|....|:|....:...
Zfish    74 AKTNDAGNQTLSEMQHVPQFHRSFIDWSQTARVALVGFCFHANFNYYWLRGLERMFPGGGTKRVS 138

  Fly    95 VKAITEQLSYGPFACVSFFMGMSLLELKTFSQAVEETKEKAAPTYKVGVCIWPILQTINFSLVPE 159
            :|.|.:||...|....:|::|:|.||  ......|:.|.|...:||.||..|..:|.:||||:|.
Zfish   139 LKVILDQLIAAPMTISAFYIGLSTLE--GAEDPFEDWKNKFWTSYKTGVVYWSTMQAVNFSLIPP 201

  Fly   160 HNRVVFVSICSLMWTIFLAYMK 181
            ..|.|||...:|.|||||.:.|
Zfish   202 AARTVFVGGVALGWTIFLCHFK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14777NP_001162634.1 Mpv17_PMP22 118..181 CDD:282035 26/62 (42%)
si:ch211-120k19.1NP_001313499.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591901
Domainoid 1 1.000 51 1.000 Domainoid score I11570
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1301408at2759
OrthoFinder 1 1.000 - - FOG0002289
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11266
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5861
SonicParanoid 1 1.000 - - X1515
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.980

Return to query results.
Submit another query.