DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14777 and CG11077

DIOPT Version :9

Sequence 1:NP_001162634.1 Gene:CG14777 / 31099 FlyBaseID:FBgn0026872 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_651944.1 Gene:CG11077 / 43831 FlyBaseID:FBgn0039930 Length:168 Species:Drosophila melanogaster


Alignment Length:165 Identity:44/165 - (26%)
Similarity:76/165 - (46%) Gaps:11/165 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KLHPMAKGALTYAVMWPAGSLIQQAMEGRK-LREYDWARALRFSLFGALYVAPTLYGWVRLTSAM 84
            :|....|..:..|.:...|..|.|....:| |.|:|..|.|||.:.|.::|.|||..|.....:.
  Fly     3 RLKAYLKDGINVAAVMCLGDTISQFFFDKKSLDEWDAGRTLRFGIVGLVFVGPTLRRWYHFLESR 67

  Fly    85 WPQT--NLRTGIVKAITEQLSYGPFACVSFFMGMSLLELKTFSQAVEETKEKAAPTYKV----GV 143
            .|:|  .:|.|:.|.:.:|..:.|    .|.|.||.|...:..:.::..:::...:|..    ..
  Fly    68 VPKTYSPMRRGVTKMLVDQTLFAP----PFTMAMSFLVPLSNGEPIDRIRQRILDSYLSILVRNY 128

  Fly   144 CIWPILQTINFSLVPEHNRVVFVSICSLMWTIFLA 178
            .:||..|.:||..||...:|::....:|:|..:|:
  Fly   129 MLWPAAQMLNFRFVPLGYQVLYAQFIALVWNCYLS 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14777NP_001162634.1 Mpv17_PMP22 118..181 CDD:282035 13/65 (20%)
CG11077NP_651944.1 Mpv17_PMP22 106..167 CDD:282035 12/58 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463162
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3570
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.