DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14777 and plh

DIOPT Version :9

Sequence 1:NP_001162634.1 Gene:CG14777 / 31099 FlyBaseID:FBgn0026872 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_649511.2 Gene:plh / 40615 FlyBaseID:FBgn0037292 Length:193 Species:Drosophila melanogaster


Alignment Length:173 Identity:78/173 - (45%)
Similarity:111/173 - (64%) Gaps:11/173 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HPMAKGALTYAVMWPAGSLIQQAM-EGRKLREYDWARALRFSLFGALYVAPTLYGWVRLTSAMWP 86
            :.:.:|.::|..:||.||||:|.| |.:..|.|||.:.|||||||..::.||:|.|:||.|.|||
  Fly    12 YKVLRGMISYGTLWPCGSLIEQTMIEKKTFRTYDWMKCLRFSLFGFFFMGPTIYVWIRLASVMWP 76

  Fly    87 QTNLRTGIVKAITEQLSYGPFACVSFFMGMSLLELKTFSQAVEETKEKAAPTYKVGVCIWPILQT 151
            :|::::.:.||||||.:|.|.|..||...|:|:|..::::|..|..:|....|||||..||.:||
  Fly    77 RTDIKSSLCKAITEQTAYDPMAISSFLFFMTLMEGNSYAEAKREVSDKFLDAYKVGVIYWPCVQT 141

  Fly   152 INFSLVPEHNRVVFVSICSLMWTIFLAYMK----------THH 184
            :||:.||..|:|||.|..|:.||.||||:|          .||
  Fly   142 VNFAFVPARNQVVFTSFFSMCWTTFLAYVKFLQLHPPVDVDHH 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14777NP_001162634.1 Mpv17_PMP22 118..181 CDD:282035 30/62 (48%)
plhNP_649511.2 Mpv17_PMP22 108..171 CDD:282035 30/62 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443434
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2313
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D114127at33392
OrthoFinder 1 1.000 - - FOG0002289
OrthoInspector 1 1.000 - - mtm1204
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1515
109.900

Return to query results.
Submit another query.