DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14777 and mpv17

DIOPT Version :9

Sequence 1:NP_001162634.1 Gene:CG14777 / 31099 FlyBaseID:FBgn0026872 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_957459.2 Gene:mpv17 / 394140 ZFINID:ZDB-GENE-040426-1168 Length:177 Species:Danio rerio


Alignment Length:181 Identity:47/181 - (25%)
Similarity:77/181 - (42%) Gaps:26/181 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GQWRRGSKL---HPMAKGALTYAVMWPAGSLI-------QQAMEGRKLREYDWARALRFSLFGAL 68
            |.||....|   ||.....:|      ||||:       ||.:|.|.|..::..|..:....|..
Zfish     3 GLWRSYQALMAKHPWKVQIIT------AGSLVGVGDVISQQLIERRGLANHNARRTAKMMSIGFF 61

  Fly    69 YVAPTLYGWVRLTSAMWPQTNLRTGIVKAITEQLSYGPFACVSFFMGMSLLELKTFS-QAVEETK 132
            :|.|.:.||.::...:.........:.|.:.:|:.:.|  |   |:|..|....|.: ..|||..
Zfish    62 FVGPVVGGWYKVLDKLVTGGTKSAALKKMLVDQVGFAP--C---FLGAFLGITGTLNGLTVEENV 121

  Fly   133 EKAAPTYKVGVC----IWPILQTINFSLVPEHNRVVFVSICSLMWTIFLAY 179
            .|....|...:.    :||.:|..||..:|.|:|:..|.|.:::|..:|::
Zfish   122 AKLQRDYTDALISNYYLWPPVQIANFYFIPLHHRLAVVQIVAVVWNSYLSW 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14777NP_001162634.1 Mpv17_PMP22 118..181 CDD:282035 19/67 (28%)
mpv17NP_957459.2 Mpv17_PMP22 112..175 CDD:282035 17/61 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.