DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14777 and CG7970

DIOPT Version :9

Sequence 1:NP_001162634.1 Gene:CG14777 / 31099 FlyBaseID:FBgn0026872 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001303378.1 Gene:CG7970 / 38205 FlyBaseID:FBgn0035252 Length:255 Species:Drosophila melanogaster


Alignment Length:169 Identity:35/169 - (20%)
Similarity:76/169 - (44%) Gaps:10/169 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HPMAKGALTYAVMWPAGSLIQQAMEGRKLREYDWARALRFSLFGALYVAPTLYGWVRLTSAMWPQ 87
            ||:...::|..|:..:.::..|.:.|.|  ..:......:.|||.::.....:.:......::.|
  Fly    85 HPVRTKSITACVLATSANVTSQRLAGAK--TLNQQSVFAYGLFGLIFGGSVPHYFYTTVERLFSQ 147

  Fly    88 TNLRTGIVKAITEQLSYGP-FACVSFFMGMSLLELKTFSQAVEETKEKAAPTYKVGVCIWPILQT 151
            ..........::|:|.|.| :..:|.|. ::|.|.|:.|.|::..::...|..|..   |..|..
  Fly   148 DVRFRRFFLFLSERLVYAPIYQALSLFF-LALFEGKSPSTALKNVEKLYWPLLKAN---WQYLSV 208

  Fly   152 ---INFSLVPEHNRVVFVSICSLMWTIFLAYMKTHHEEQ 187
               :||:.||...|.:.::|.|.:|.:::|..:...:::
  Fly   209 FVYLNFAYVPPMFRSISMAIISFIWVVYIAQKRRRFQDK 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14777NP_001162634.1 Mpv17_PMP22 118..181 CDD:282035 18/65 (28%)
CG7970NP_001303378.1 Mpv17_PMP22 178..238 CDD:282035 17/62 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463159
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3483
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.