DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14777 and CG1662

DIOPT Version :9

Sequence 1:NP_001162634.1 Gene:CG14777 / 31099 FlyBaseID:FBgn0026872 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster


Alignment Length:248 Identity:58/248 - (23%)
Similarity:92/248 - (37%) Gaps:65/248 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LQASLGQWRRGSKLHPMAKGALTYAVMWPAGSLIQQAMEG-------------------RKLREY 54
            :|:..|...||..|....:|..:..:.||..|.......|                   :|||| 
  Fly     1 MQSLRGCPARGLILSRAIRGQRSLRMSWPRNSSATGGAGGAAPGGGSSTTTSTIGFGALQKLRE- 64

  Fly    55 DW---ARALRFSLFGALYVAPTL----------------------------------------YG 76
             |   |.:.||.||..:.::.||                                        :.
  Fly    65 -WHASAFSSRFLLFTNVGISLTLSCVGDVLEQHLEIYCGEIERFESTRTAHMAISGVTVGVICHY 128

  Fly    77 WVRLTSAMWPQTNLRTGIVKAITEQLSYGPFACVSFFMGMSLLELKTFSQAVEETKEKAAPTYKV 141
            |.::.....|...:|....|.:.:||...|....:||:.:.|||.||..:..||.||||...|..
  Fly   129 WYKMLDKRMPGRTMRVVAKKIVLDQLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKLYAA 193

  Fly   142 GVCIWPILQTINFSLVPEHNRVVFVSICSLMWTIFLAYMKTHHEEQSNSAVLP 194
            ...:||:.|.:||..:|.|.|:.:.:|.||.:.:..:.:| |.:..|:...:|
  Fly   194 EWTVWPVAQFVNFYWIPTHYRIFYDNIISLGYDVLTSKVK-HKQSHSHLKKIP 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14777NP_001162634.1 Mpv17_PMP22 118..181 CDD:282035 23/62 (37%)
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 24/64 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463152
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.