DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14777 and SPAC4G9.14

DIOPT Version :9

Sequence 1:NP_001162634.1 Gene:CG14777 / 31099 FlyBaseID:FBgn0026872 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_593696.1 Gene:SPAC4G9.14 / 2543598 PomBaseID:SPAC4G9.14 Length:221 Species:Schizosaccharomyces pombe


Alignment Length:183 Identity:42/183 - (22%)
Similarity:82/183 - (44%) Gaps:26/183 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KLHPMAKGALTYAVMWPAGSLIQQAMEGRKLREY------------------------DWARALR 61
            :|.|:....|..|.:.....|:.||::..||.::                        |..|.:|
pombe    30 ELQPLLTLGLLNASLTALSDLLAQALDSYKLLKFRNKRDVSLEKYGNTILLPASTSKLDVHRTIR 94

  Fly    62 FSLFGALYVAPTLYGW-VRLTSAMWPQTNLRTGIVKAITEQLSYGPFACVSFFMGMSLLELKTFS 125
            ::.:| |.:.|..:.| |.|::.:..:......:::...:|..:.|...|.||:.|.:.|.|::.
pombe    95 YAAYG-LCLTPIQFRWFVALSNVIQTENPFIAIVLRVALDQFIFAPLGIVFFFLFMGITECKSYE 158

  Fly   126 QAVEETKEKAAPTYKVGVCIWPILQTINFSLVPEHNRVVFVSICSLMWTIFLA 178
            :.....::...||.|....:||.:|..||:.||...:|:|.:..|::||.:|:
pombe   159 RLKSYFRKHYWPTLKANYILWPAVQLFNFTFVPLVLQVIFANAVSMVWTAYLS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14777NP_001162634.1 Mpv17_PMP22 118..181 CDD:282035 18/61 (30%)
SPAC4G9.14NP_593696.1 Mpv17_PMP22 151..215 CDD:282035 18/61 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9262
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.