DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14777 and Mpv17l2

DIOPT Version :9

Sequence 1:NP_001162634.1 Gene:CG14777 / 31099 FlyBaseID:FBgn0026872 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_898993.1 Gene:Mpv17l2 / 234384 MGIID:2681846 Length:200 Species:Mus musculus


Alignment Length:185 Identity:50/185 - (27%)
Similarity:84/185 - (45%) Gaps:15/185 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SLGQWRRGSKL----HPMAKG-------ALTYAVMWPAGSLIQQAMEGRKLREYDWARALRFSLF 65
            :||.||...|.    .|:.:|       .|...|:..||...:|..|.|......::.....|:|
Mouse     2 ALGGWRWARKALAAGRPLFQGRALLLTNTLGCGVLMAAGDGARQVWEVRARPGQRFSARRSASMF 66

  Fly    66 G-ALYVAPTLYGWVRLTSAMWPQTNLR---TGIVKAITEQLSYGPFACVSFFMGMSLLELKTFSQ 126
            . ...:.|.|:.|......:.|.:.||   :.:.|.:.:|....|...|.:|:|:..||.:|..:
Mouse    67 AVGCSMGPFLHFWYLWLDRLLPASGLRSLPSVMKKVLVDQTVASPILGVWYFLGLGSLEGQTLEE 131

  Fly   127 AVEETKEKAAPTYKVGVCIWPILQTINFSLVPEHNRVVFVSICSLMWTIFLAYMK 181
            :.:|.:.|....||...|:||..|.:||..:|.|.||.:::..:|.|..:|:|:|
Mouse   132 SCQELRAKFWDFYKADWCVWPAAQLVNFLFIPSHFRVTYINGLTLGWDTYLSYLK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14777NP_001162634.1 Mpv17_PMP22 118..181 CDD:282035 21/62 (34%)
Mpv17l2NP_898993.1 Mpv17_PMP22 124..186 CDD:282035 21/61 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.