DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14777 and Mpv17

DIOPT Version :9

Sequence 1:NP_001162634.1 Gene:CG14777 / 31099 FlyBaseID:FBgn0026872 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001297457.1 Gene:Mpv17 / 17527 MGIID:97138 Length:178 Species:Mus musculus


Alignment Length:178 Identity:48/178 - (26%)
Similarity:78/178 - (43%) Gaps:15/178 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 WR---RGSKLHPMAKGALTYAVMWPAGSLI-QQAMEGRKLREYDWARALRFSLFGALYVAPTLYG 76
            ||   |....||.....||...:...|.:| ||.:|.|.|:::...|.|.....|..:|.|.:.|
Mouse     4 WRAYQRALAAHPWKVQVLTAGSLMGVGDMISQQLVERRGLQQHQAGRTLTMVSLGCGFVGPVVGG 68

  Fly    77 WVRLTSAMWPQTNLRTGIVKAITEQLSYGP--FAC----VSFFMGMSLLELKTFSQAVEETKEKA 135
            |.::...:.|.|.....:.|.:.:|..:.|  ..|    |....|||..:  .:::...:..:..
Mouse    69 WYKVLDHLIPGTTKVHALKKMLLDQGGFAPCFLGCFLPLVGILNGMSAQD--NWAKLKRDYPDAL 131

  Fly   136 APTYKVGVCIWPILQTINFSLVPEHNRVVFVSICSLMWTIFLAYMKTH 183
            ...|.|.  :||.:|..||.|||.|.|:..|...:::|..:|:: |.|
Mouse   132 ITNYYVR--LWPAVQLANFYLVPLHYRLAVVQCVAIVWNSYLSW-KAH 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14777NP_001162634.1 Mpv17_PMP22 118..181 CDD:282035 15/62 (24%)
Mpv17NP_001297457.1 Mpv17_PMP22 110..176 CDD:282035 19/70 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.