DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14777 and LOC100497159

DIOPT Version :9

Sequence 1:NP_001162634.1 Gene:CG14777 / 31099 FlyBaseID:FBgn0026872 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_002934856.2 Gene:LOC100497159 / 100497159 -ID:- Length:213 Species:Xenopus tropicalis


Alignment Length:196 Identity:60/196 - (30%)
Similarity:89/196 - (45%) Gaps:13/196 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLQASLGQWRR---GSKLHPMAKGALTYAVMWPAGSLIQQAMEGRKLRE--YDWARALRFSLFGA 67
            ||...:|.|::   |..|  :....::..|:...|..|||..|.|:.:|  .||.|..|....|.
 Frog     8 LLTRFVGSWKQLFTGQTL--LITNTVSAGVLLSTGDAIQQTWEMRRNKEKKRDWLRTGRMFAIGC 70

  Fly    68 LYVAPTLYGWVRLTSAMWPQTNLRTGIVKAITEQLSYGPFACVSFFMGMSLLELKTFSQAVEETK 132
            . :.|..:.|......:.|...:|..:.|.:.||:...|.....||||..|:|..:..::..|.|
 Frog    71 C-LGPVDHYWYVFLDRILPGATVRVVLKKVLVEQIVASPILGTMFFMGTGLMEGHSVEESWVEFK 134

  Fly   133 EKAAPTYKVGVCIWPILQTINFSLVPEHNRVVFVSICSLMWTIFLAYMK-----THHEEQSNSAV 192
            .|....|||..|:||..|.|||..:|...||::|:..:|.|.|:|.|:|     ||.....:..|
 Frog   135 GKFWEMYKVEWCVWPPAQIINFYFLPTKYRVMYVNFVTLAWDIYLCYLKHKNPVTHETPAKSEEV 199

  Fly   193 L 193
            |
 Frog   200 L 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14777NP_001162634.1 Mpv17_PMP22 118..181 CDD:282035 24/62 (39%)
LOC100497159XP_002934856.2 Mpv17_PMP22 119..180 CDD:367825 22/60 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.